PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00025757-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 402aa    MW: 44989.8 Da    PI: 5.0535
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00025757-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.71.9e-52321591128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                            l+pGfrFhPtdeelv +yL++kv gk++++ ++++e+d+yk+ePw+L +  ++k+++ ewyfFs+ d+ky +g+r nrat +gyWkat
  SMil_00025757-RA_Salv  32 LAPGFRFHPTDEELVRYYLRRKVCGKPFRF-QAVTEIDVYKSEPWELAEysSLKTRDLEWYFFSPVDRKYGNGSRLNRATGKGYWKAT 118
                            579*************************99.88**************84346777888****************************** PP

                    NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            gkd++v + k++ +g+kktLvf++grap+g++t+Wvmheyrl
  SMil_00025757-RA_Salv 119 GKDRSVRH-KNQSIGMKKTLVFHSGRAPDGKRTNWVMHEYRL 159
                            ********.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.15E-6229182IPR003441NAC domain
PROSITE profilePS5100557.89232182IPR003441NAC domain
PfamPF023651.9E-2834159IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
LGMEMGQEVV VAAVGSSAAP SPRMGAPPPT SLAPGFRFHP TDEELVRYYL RRKVCGKPFR  60
FQAVTEIDVY KSEPWELAEY SSLKTRDLEW YFFSPVDRKY GNGSRLNRAT GKGYWKATGK  120
DRSVRHKNQS IGMKKTLVFH SGRAPDGKRT NWVMHEYRLC DSELETAGIL QDAFVLCRIF  180
QKSGLGPPNG DRYAPFIEEE WDEDAPLVIP GGDVEDDVAN GDEVRGECMD LDQDTQPLSI  240
APPLVKYPVE STCIPFLCKR ERAAVDPEPL SLDHSKRSKH DDPNSSNANG SEDSTTTSQD  300
PSSMMMMTKI NSSPLEFPLL ETLGSKDNLP ANAPTFDSAN LEKSVPPGYL KFISNLENEI  360
LNISMEKETL KIEVMRAQAM INILQSRVES LTKENEDCRR RA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-513118216165NO APICAL MERISTEM PROTEIN
1ut4_B3e-513118216165NO APICAL MERISTEM PROTEIN
1ut7_A3e-513118216165NO APICAL MERISTEM PROTEIN
1ut7_B3e-513118216165NO APICAL MERISTEM PROTEIN
3swm_A3e-513118219168NAC domain-containing protein 19
3swm_B3e-513118219168NAC domain-containing protein 19
3swm_C3e-513118219168NAC domain-containing protein 19
3swm_D3e-513118219168NAC domain-containing protein 19
3swp_A3e-513118219168NAC domain-containing protein 19
3swp_B3e-513118219168NAC domain-containing protein 19
3swp_C3e-513118219168NAC domain-containing protein 19
3swp_D3e-513118219168NAC domain-containing protein 19
4dul_A3e-513118216165NAC domain-containing protein 19
4dul_B3e-513118216165NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101542.10.0PREDICTED: NAC domain-containing protein 78 isoform X2
TrEMBLA0A068TWS90.0A0A068TWS9_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000797910.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31402448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.21e-112NAC domain containing protein 50